Human PIGF, His tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	PLGF
Accession	P49763-2
Amino Acid Sequence	Protein sequence (P49763-2, Leu19-Arg149, with C-10*His) LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRRGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Theoretical: 16.4kDa Actual: 30kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Placental growth factor (PIGF) is a member of the VEGF (vascular endothelial growth factor) sub-family - a key molecule in angiogenesis and vasculogenesis, in particular during embryogenesis. The main source of PIGF during pregnancy is the placental trophoblast. PIGF is also expressed in many other tissues, including the villous trophoblast. Placental growth factor-expression within human atherosclerotic lesions is associated with plaque inflammation and neovascular growth. Serum levels of PIGF and sFlt-1 (soluble fms-like tyrosine kinase-1, also known as soluble VEGF receptor-1) are altered in women with preeclampsia.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.