Human CY211, His Tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Cy211
Accession	P08727
Amino Acid Sequence	Protein sequence(P08727, Ser239-Leu400 with C-10*His) SAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVLGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Theoretical: 20kDa Actual: 22kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Cytokeratin 19 fragment antigen (Cy211) belongs to a cytokeratin family, which is normally expressed in epithelial tissues and forms the epithelial cells’ filament cytoskeleton. Cy211 is useful as a tumor marker, especially for non-small cell lung cancer (NSCLC) along with carcinoembryonic antigen (CEA) and squamous cell carcinoma–associated antigen (SCC), but also for other epithelial tumors such as bladder cancer. This elevation in tumors may be due to cell lysis, releasing cell contents to the blood, including Cy211 by the action of proteases that degrade the cytokeratin filaments

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.