Monkeypox virus A29L, His Tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	MPXV
Synonyms	A29L, Mpox, Monkeypox
Accession	Q9YN60
Amino Acid Sequence	Protein sequence(Q9YN60, Met1-Glu110 with C-10*His) MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Theoretical: 14.2kDa Actual: 16-23kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

A29L is highly homologous to Vaccinia virus envelope protein A27. A27 has multiple functions and is conserved in the Orthopoxvirus genus of the poxvirus family. A27 protein binds to cell surface heparan sulfate, provides an anchor for A26 protein packaging into mature virions, and is essential for egress of mature virus (MV) from infected cells.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.