Human IFN-α2, His Tag,Starter_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	Interferon alpha-2, Interferon alpha-A,IFNA2
Accession	P01563
Amino Acid Sequence	Protein sequence(P01563, Cys24-Glu188, with C-10*His) CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEGGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	Theoretical:20.9kDa Actual:20,24kDa
Purity	>95% by SDS-PAGE
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human interferon alpha-2 (IFNα2) is a cytokine belonging to the family of type I IFNs. IFNα2 is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection.IFNα2 was the first subtype to be characterized in the early eighties. As a result, IFNα2 was widely used in basic research to elucidate biological activities, structure and mechanism of action of type I IFNs. IFNα2 was also the first IFN to be produced by the pharmaceutical industry for use as a drug.In addition to their antiviral activity, type I IFNs also inhibit the proliferation of cells and regulate the activation of the immune system.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.