Login    Join free Add to favorites    中文
Home >Products> Reagents >Biochemistry> Recombinant Human Interleukin-17A ( MBP tagged) ( IL17A)
Recombinant Human Interleukin-17A ( MBP tagged) ( IL17A)
Recombinant Human Interleukin-17A ( MBP tagged) ( IL17A)
Origin of place United States
Model RP1008
Supplier Biowit Technologies
Price $500/100UG
Hits 1024
Updated 5/4/2012
  • Product Detail
  • Company Profile

Recombinant Human Interleukin-17A ( MBP tagged) ( IL17A)

Recombinant (E. coli)

Lyophilizate, sterile-filtered

Cat.No.     RP1008                       100 μg                  store at -20 ℃

Synonyms :  CTLA-8, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, IL17A.

Description: Interleukin-17A Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 138 amino acids fragment and having a molecular weight of 61kDa. The IL-17A is fused to a 42KDa MBP tag at its N-terminus and purified by proprietary chromatographic techniques.

Source:        Escherichia coli.

Purity:         Greater than 95.0% as determined by SDS-PAGE.

Endotoxin Level: Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.

Amino acid sequence:

METKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMETFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMETNADTDYSIAEAAFNKGETAMETTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMETENAQKGEIMETPNIPQMETSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGIEGRISEFGSMETIVKAGITIPRNPGCPNSEDKNFPRTVMETVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMETNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCT CVTPIVHHVA

Formulation & Storage: It was lyophilized from sterile 10 mM sodium phosphate ( pH 6.0) and we recommend that the powder be reconstituted in sterile 10 mW-cm H2O. Upon reconstitution Interleukin-17A should be stored at 4°C. For long-term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.

Usage:  The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.

bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Copyright(C) 2006-2026 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号