Recombinant Human Basic Fibroblast Growth Factor (bFGF /FGF2)

Recombinant (E.coli)

Lyophilizate, sterile-filtered

Cat.No.     RP1002                       10 μg                 store at -20 ℃

Description:  Fibroblast Growth Factor-2 Human Recombinant (FGF-2) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17397 Dalton.

Source:        Escherichia coli.

Purity:         Greater than 95.0% as determined by SDS-PAGE.

Endotoxin Level: Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.

Biological Activity: The ED50, measured in a mitogenic assay using quiescent NR6R-3T3 fibroblasts was found to be less than 0.1 ng/ml, corresponding to a specific activity of 3 x 10⁶ Units/mg.

Amino acid sequence: GSMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Formulation & storage: It was lyophilized from sterile 10 mM sodium phosphate (pH7.4) and we recommend that the powder be reconstituted in sterile 10 mW-cm H2O. Upon reconstitution, FGF2 should be stored at 4°C. For long- term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.

Usage:  The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.

Biowit Technologies Ltd. is a high-tech company specialized in providing R&D services and related products in the biological field. As a technology-driven and customer-focused company, BioWit provides a broad and integrated service and product portfolio including molecular biology, virus packaging (e.g., adenovirus, AAV, lentivirus, retrovirus and baculovirus), protein expression, cell biology, stem cells and transgenic models. One of the milestones achieved by Biowit is its recent sucess in the development of a series of serum-containing media as well as serum-free or animal -free media for stem cell culture, which are tailored for clinical applications. The core technology team members have engaged in research and development for many years in world-famous academic institutions or prestigious drug companies. Biowit has established collaboration with international prestigious research institutions. The worldwide collaboration enables Biowit to timely renew its biotechnologies (http://www.biowit.com).