Login    Join free Add to favorites    中文
Home >Products> Reagents >Biochemistry> Recombinant Human Basic Fibroblast Growth Factor (bFGF /FGF2)
Recombinant Human Basic Fibroblast Growth Factor (bFGF /FGF2)
Recombinant Human Basic Fibroblast Growth Factor (bFGF /FGF2)
Origin of place United States
Model RP1002
Supplier Biowit Technologies
Price $100/10UG
Hits 1258
Updated 5/4/2012
  • Product Detail
  • Company Profile

Recombinant Human Basic Fibroblast Growth Factor (bFGF /FGF2)

Recombinant (E.coli)

Lyophilizate, sterile-filtered

Cat.No.     RP1002                       10 μg                 store at -20 ℃

Synonyms :  Fibroblast Growth Factor-basic, FGF-2, HBGF-2, HBGH-2, FGF-b, Prostatropin

Description:  Fibroblast Growth Factor-2 Human Recombinant (FGF-2) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17397 Dalton.

Source:        Escherichia coli.

Purity:         Greater than 95.0% as determined by SDS-PAGE.

Endotoxin Level: Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.

Biological Activity: The ED50, measured in a mitogenic assay using quiescent NR6R-3T3 fibroblasts was found to be less than 0.1 ng/ml, corresponding to a specific activity of 3 x 106 Units/mg.

Amino acid sequence: GSMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Formulation & storage: It was lyophilized from sterile 10 mM sodium phosphate (pH7.4) and we recommend that the powder be reconstituted in sterile 10 mW-cm H2O. Upon reconstitution, FGF2 should be stored at 4°C. For long- term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.

Usage:  The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.

bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Copyright(C) 2006-2026 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号