Recombinant Mouse Leukemia inhibitory factor (LIF)
Recombinant (E. coli) Lyophilizate, sterile-filtered
Cat. No. RP1001 10 µg store at -20℃
Synonyms : CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA.
Description: Mouse Recombinant Leukemia Inhibitory Factor (LIF) produced in E. coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa.
Source: Escherichia coli.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Endotoxin Level : Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.
Biological Activity : Activity of mouse LIF was determined by its ability to induce differentiation of murine M1myeloid leukemic cells. The specific activity is 100mIU/mg, where 50U is defined as the amount of murine LIF required to induce differentiation in 50% of the M1 colonies per ml of agar culture.
GSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Formulation & Storage: It was lyophilized from sterile 10 mM sodium phosphate ( pH 7.4) and we recommend that the powder be reconstituted in sterile 10 mW-cm H2O. Epidermal Growth Factor (EGF) should be stored desiccated below -20°C. Upon reconstitution, EGF should be stored at 4°C For long-term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.
Usage: The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.
bio-equip.cn
Biowit Technologies Ltd. is a high-tech company specialized in providing R&D services and related products in the biological field. As a technology-driven and customer-focused company, BioWit provides a broad and integrated service and product portfolio including molecular biology, virus packaging (e.g., adenovirus, AAV, lentivirus, retrovirus and baculovirus), protein expression, cell biology, stem cells and transgenic models. One of the milestones achieved by Biowit is its recent sucess in the development of a series of serum-containing media as well as serum-free or animal -free media for stem cell culture, which are tailored for clinical applications. The core technology team members have engaged in research and development for many years in world-famous academic institutions or prestigious drug companies. Biowit has established collaboration with international prestigious research institutions. The worldwide collaboration enables Biowit to timely renew its biotechnologies (http://www.biowit.com).
中文
