Home >Products> Reagents >ELISA / Diagnostic Kits> GIP
Reagents:  Molecular Biology   Biochemistry   Cell Biology   ELISA / Diagnostic Kits   Antibody   Serum/Medium   Other Reagents  
GIP
Place of Origin:
United States
Brand:
USA
Model:
1 mg
Price:
4800.00
Hits:
434 
Updated:
7/2/2025
  • Product Detail
  • Company Profile
    MFC226H343N61O66S1 : ; MW:5002.60 ; YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNITQ, Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln


    ===========================================================================
    Antibody Arrays and Their Applications

    1/Array Product Portfolio
    Cytokine Antibody Arrays for
    Human, Mouse and Rat samples
    Quantitative and semi-quantitative
    ELISA Sandwich and Label-based

    Phosphorylation Antibody Arrays
    RTK and EGFR

    Antibody Array Analysis software
    Protein Arrays

    2/Array using protein as a capture molecule
    Recombinant/Purified Protein
    Antibody
    Peptide arrays
    Reversed phase (biological samples)
    Transcription factor
    Tissue arrays


    3/Types of Cytokine Array Targets

    Cytokines
    Inflammatory factors (interleukins, etc.)
    Chemokines
    Angiogenesis
    Atherosclerosis
    MMPs
    Growth Factors
    Adipokines
    Soluble receptor
    Signal transduction (Phosphorylation)
    Broad Screen (all of the above)

    4/全球领先优势:

     Global analysis of gene or protein expression
     High-throughput assays
     Substantially reduced costs
     Small sample volume

    5/Antibody Arrays vs. Mass Spec

     “Unbiased” = abundant
    Nanogram/ml vs. picogram/ml sensitivity
     Cheaper per sample
     Faster throughput
     Speeds up discovery process: Discovery
    Validation
    Application
    All in one platform

    6/Antibody Arrays vs. Luminex

     Affixing capture Ab reduces interactions
     Can screen hundreds of proteins
     More flexibility
    Equipment
    Mode of detection (Fluor, Chemi, Color)
     Less equipment maintenance


    7/cDNA Arrays vs. Antibody Arrays

     cDNA arrays measure only RNA levels
     ↑ RNA ≠↑protein levels or function
     Protein functions are modulated by
    Interactions with other proteins, DNA and/or RNA
    Biochemical modification of individual amino acids
     Antibody arrays measure protein levels
    Can demonstrate patterns of coupled protein expression
    Can detect biochemical modifications of protein
    Can be used to detect protein-protein, protein-DNA or protein-RNA interactions
    Results are more biologically meaningful

    8/Formats

     Membrane
    Chemiluminescence detection
     Glass Slides
    Fluorescence detection
     96-Well Plate
     Sandwich ELISA Array
     Label-based Array
     Quantitative vs. Semi-Quantitative

    9/Features of Cytokine Antibody Array (membrane-based):

     Detection
    Up to 274 cytokines in one experiment.
    Detection in picogram(pg) range.
     Highly specific, little cross-reactivity
     Handles a wide range of samples
    Conditioned media, plasma, serum , urine and other body fluids
    Cell or tissue lysates
     Requires low sample volumes
    As little as 100 μLof sample
     Easy to use, requires no specialized equipment
     Cost-effective for routine use


    10/Advantages of Cytokine Array System: G-Series

     Requires laser fluorescence scanner
     Sensitivity similar to membrane arrays
     Greater dynamic range
     Cheaper per sample than membranes
     High-throughput (100’s of samples/day)
     Small sample volume (10-50 μL/array)


    ===========================================================================
    BIO--T.N.T.

    Add: Shanghai Jiaotong University Haike Technology Park
    Room A-515,No.1500 Longwu Road,shanghai 200231,P.R.China
    Tel: 0086-21-51692391 Fax:0086-21-51692391
    Web: www.biotnt.com Email:biotnt@biotnt.com
    Online:transhold@hotmail.com(MSN) 306493040(QQ) 13892737(QQ)




















    bio-equip.cn
    BioTNT, established in 1999, is a privately held corporation located in national high-tech park of Shanghai jiangtong university longwu base. BioTNT is the leading resource for up-to-date product information, product reviews, and new technologies for worldwide life reseach scientists in the bio-technological industry. Our mission statement clearly identifies and sets the direction for our company: “ provide research products of gene tests and immunoassay tests with high quality and a very competitive price to meet the growing needs of international professionals.we aim to speed the progress of research by letting people use our technology in a manner that’s substantially more flexible than that of other tools providers.”

    In the past 10 years of development, our company has formed an a wide range of products and a entire professnial technical services to help our customers succeed. We have successful developed a strong line of ELISA kit products including human, rat,mouse,pig,Canine,rabbit and Guinea Pig.Transhlod has won a extensive appreciation for our high quailty products of ELISA kit by life scientists and researchers in European countries and our company has a rich experience in export trade . Further,we also supply a series products for real-time PCR .Hot Start Taq DNA is one of our very compatitive produces. It’s would be your best choice if the requirements of PCR experiments is high. Recently ,we foucs on the research and development of PCR PreMix kit . This produce will enableus to be the leader in the field of PCR technology and to have a solid communication with the scientific community. Our empolyees desire to provide a convenient and time-saving way for customers by using our produces.

    Through continuing development, BioTNT is committed to building a portfolio of quality products. Using only the highest standards, we deliver our products to the market place at highly quality and affordable prices.It is our goal to continually research and develop novel tests systems to enhance the quality of life research.
Request Information
Request Information: yes no
Request Quotation: yes no
refresh

I agree to share my inquiry with the other matching suppliers.

Request Information

* Name:
Job Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request Information:
yes no
Request Quotation:
yes no
* Message:
* Verification Code:
refresh
I agree to share my inquiry to the other matching suppliers.