Home >Products> Reagents >Biochemistry> Recombinant Human Acidic Fibroblast Growth Factor (aFGF/FGF1)
Reagents:  Molecular Biology   Biochemistry   Cell Biology   ELISA / Diagnostic Kits   Antibody   Serum/Medium   Other Reagents  
Recombinant Human Acidic Fibroblast Growth Factor (aFGF/FGF1)
Recombinant Human Acidic Fibroblast Growth Factor (aFGF/FGF1)
Place of Origin:
United States
Brand:
biowit
Model:
RP1003
Price:
$150/10UG
Hits:
1184 
Updated:
5/4/2012
  • Product Detail
  • Company Profile
    Recombinant Human Acidic Fibroblast Growth Factor (aFGF/FGF1)

     Recombinant (E. coli)

    Lyophilizate, sterile-filtered

     Cat.No.     RP1003                       10 μg                  store at -20

     Synonyms :  Fibroblast Growth Factor-acidic, FGF-1, HBGF-1, ECGF-beta, FGF-a

     Description:  Human Recombinant Fibroblast Growth Factor-1 (FGF-1) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 155 amino acids and having a molecular mass of 17460 Dalton.

     Source:        Escherichia coli.

     Purity:         Greater than 95.0% as determined by SDS-PAGE.

     Endotoxin Level: Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.

    Biological Activity: The ED50, calculated by the dose-dependent proliferation of mouse BALB/c 3T3 cells is <1.0 ng/ml, corresponding to a Specific Activity of 1 x 1,000,000 IU/mg.

    Amino acid sequence:

    MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

     Formulation & Storage: It was lyophilized from sterile 10 mM sodium phosphate ( pH 7.4) and we recommend that the powder be reconstituted in sterile 10 mW-cm H2O. Upon reconstitution aFGF should be stored at 4°C. For long-term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.

     Usage:  The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals

    bio-equip.cn
    ArkOne Biotechnologies, Inc. is a global distributor of high quality biochemical reagents and lab research tools for protein chemistry, molecular biology, and cell biology including a series of DNA vectors, purified proteins of high quality, and media for cell culture. The pre-selected media are suitable for stem cell culture, especially for those mammalian stem cells isolated from bone marrow, umbilical cord, and adipose tissues. By using these media, cells can be quickly expanded with minimal differentiation.The serum media contain essential and non-essential amino acids, vitamins, organic and inorganic compounds, hormones, growth factors, trace minerals and pre-selected fetal bovine serum and other supplements. The serum-free media contain defined animal-free components and key cytokine supplements, targeting clinical applicaiton. We also provide packaging services for a variety of viruses including intergrative viruses and non-integrative viruses of high titer. Integrative viruses are suitable for rapid generation of stable cell lines. These viruses include retrovirus and classical lentivirus. Non-integrative viruses include modified lentivirus, adenovirus and adeno-associated viruses (AAV) with serotypes ranging from AAV2/1 to AAV2/9. Non-integrative viruses can serve as excellent options for transient transfection as well as for gene delivery treatment (http://).

Request Information
Request Information: yes no
Request Quotation: yes no
refresh

I agree to share my inquiry with the other matching suppliers.

Request Information

* Name:
Job Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request Information:
yes no
Request Quotation:
yes no
* Message:
* Verification Code:
refresh
I agree to share my inquiry to the other matching suppliers.