Recombinant Mouse Leukemia inhibitory factor (LIF)
Recombinant (E. coli) Lyophilizate, sterile-filtered
Cat. No. RP1001 10 µg store at -20℃
Synonyms : CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA.
Description: Mouse Recombinant Leukemia Inhibitory Factor (LIF) produced in E. coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa.
Source: Escherichia coli.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Endotoxin Level : Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.
Biological Activity : Activity of mouse LIF was determined by its ability to induce differentiation of murine M1myeloid leukemic cells. The specific activity is 100mIU/mg, where 50U is defined as the amount of murine LIF required to induce differentiation in 50% of the M1 colonies per ml of agar culture.
GSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Formulation & Storage: It was lyophilized from sterile 10 mM sodium phosphate ( pH 7.4) and we recommend that the powder be reconstituted in sterile 10 mW-cm H2O. Epidermal Growth Factor (EGF) should be stored desiccated below -20°C. Upon reconstitution, EGF should be stored at 4°C For long-term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.
Usage: The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.
bio-equip.cn
中文
