LTBR/TNFRSF3 Fc Chimera Protein, Human,UA BIOSCIENCE_specification/price/image

Product Detail
Company Profile

Product Specification

Species	Human
Antigen	LTBR/TNFRSF3
Synonyms	Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein
Accession	P36941
Amino Acid Sequence	Gln31-Met227, with C-terminal Human IgG Fc QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System	HEK293
Molecular Weight	55-65kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	Human Fc Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. Piao W., Xiong Y., Li L., et al. Regulatory T cells condition lymphatic endothelia for enhanced transendothelial migration. Cell Reports. 2020;30(4):1052-1062.e5. 2. Schneider K, Potter KG, and Ware CF (2004). Lymphotoxin and LIGHT signaling pathways and target genes. Immunol. Rev. 202, 49-66. 3. Norris P.S., Ware C.F. Madame Curie Bioscience Database. Landes Bioscience; Austin, TX, USA: 2000-2013. 4. Force W.R., Walter B.N., Hession C., Tizard R., Kozak C.A., Browning J.L., Ware C.F. Mouse lymphotoxin-beta receptor. Molecular genetics, ligand binding, and expression. J. Immunol. 1995; 155:5280-5288. 5. Boehm T., Scheu S., Pfeffer K., Bleul C.C. Thymic medullary epithelial cell differentiation, thymocyte emigration, and the control of autoimmunity require lympho-epithelial cross talk via LTbetaR. J. Exp. Med. 2003; 198:757-769.

Background

LTBR is a type 1 single transmembrane protein and member of the tumor necrosis factor receptor (TNFR) family that plays a critical role in the development of secondary lymphoid organs. The human LTBR gene is located on chromosome 12p13, in the same locus as two other members of the TNFR family—TNFR1 and CD27. The human LTBR gene shares 76% homology at the nucleic acid level with its mouse counterpart, located on chromosome 6. LTBR is widely expressed in blood and LECs, intestinal epithelial cells, dendritic cells (DCs), and lymph node (LN) stromal cells. The protein is conspicuously absent in T cells, B cells, and NK cells. LTBR binds strongly to two different natural ligands in homeostatic conditions, LTα1β2 and LIGHT (TNFSF14). LTBR signaling pathway plays an essential role in lymphatic organogenesis, tissue regeneration, organ development, tumorigenesis, and immune response to pathogen infection. Functionally, the absence of LTBR signaling leads to the retention of mature T cells in the thymic medulla.

AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.