Login    Join free Add to favorites    中文
Home >Products> Reagents >Biochemistry> Recombinant Human Acidic Fibroblast Growth Factor (aFGF/FGF1)
Recombinant Human Acidic Fibroblast Growth Factor (aFGF/FGF1)
Recombinant Human Acidic Fibroblast Growth Factor (aFGF/FGF1)
Origin of place United States
Model RP1003
Supplier ArkOne Biotechnologies, Inc.
Price $150/10UG
Hits 1189
Updated 5/4/2012
  • Product Detail
  • Company Profile
Recombinant Human Acidic Fibroblast Growth Factor (aFGF/FGF1)

 Recombinant (E. coli)

Lyophilizate, sterile-filtered

 Cat.No.     RP1003                       10 μg                  store at -20

 Synonyms :  Fibroblast Growth Factor-acidic, FGF-1, HBGF-1, ECGF-beta, FGF-a

 Description:  Human Recombinant Fibroblast Growth Factor-1 (FGF-1) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 155 amino acids and having a molecular mass of 17460 Dalton.

 Source:        Escherichia coli.

 Purity:         Greater than 95.0% as determined by SDS-PAGE.

 Endotoxin Level: Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.

Biological Activity: The ED50, calculated by the dose-dependent proliferation of mouse BALB/c 3T3 cells is <1.0 ng/ml, corresponding to a Specific Activity of 1 x 1,000,000 IU/mg.

Amino acid sequence:

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

 Formulation & Storage: It was lyophilized from sterile 10 mM sodium phosphate ( pH 7.4) and we recommend that the powder be reconstituted in sterile 10 mW-cm H2O. Upon reconstitution aFGF should be stored at 4°C. For long-term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.

 Usage:  The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals

bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Copyright(C) 2006-2026 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号