Login    Join free Add to favorites    中文
Home >Products> Reagents >Biochemistry> Recombinant Human Basic Fibroblast Growth Factor (bFGF, FGF2)
Recombinant Human Basic Fibroblast Growth Factor (bFGF, FGF2)
Recombinant Human Basic Fibroblast Growth Factor (bFGF, FGF2)
Origin of place United States
Model RP1002
Supplier ArkOne Biotechnologies, Inc.
Price $100/10UG
Hits 1509
Updated 5/4/2012
  • Product Detail
  • Company Profile

Recombinant Human Basic Fibroblast Growth Factor (bFGF /FGF2)

Recombinant (E.coli)

Lyophilizate, sterile-filtered

Cat.No.     RP1002                       10 μg                 store at -20 ℃

Synonyms :  Fibroblast Growth Factor-basic, FGF-2, HBGF-2, HBGH-2, FGF-b, Prostatropin

Description:  Fibroblast Growth Factor-2 Human Recombinant (FGF-2) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17397 Dalton.

Source:        Escherichia coli.

Purity:         Greater than 95.0% as determined by SDS-PAGE.

Endotoxin Level: Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.

Biological Activity: The ED50, measured in a mitogenic assay using quiescent NR6R-3T3 fibroblasts was found to be less than 0.1 ng/ml, corresponding to a specific activity of 3 x 106 Units/mg.

Amino acid sequence: GSMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Formulation & storage: It was lyophilized from sterile 10 mM sodium phosphate (pH7.4) and we recommend that the powder be reconstituted in sterile 10 mW-cm H2O. Upon reconstitution, FGF2 should be stored at 4°C. For long- term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.

Usage:  The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.

bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Copyright(C) 2006-2025 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号