Recombinant Human Interleukin-17A ( MBP tagged) ( IL17A)
Recombinant (E. coli)
Lyophilizate, sterile-filtered
Cat.No. RP1008 100 μg store at -20 ℃
Synonyms : CTLA-8, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, IL17A.
Description: Interleukin-17A Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 138 amino acids fragment and having a molecular weight of 61kDa. The IL-17A is fused to a 42KDa MBP tag at its N-terminus and purified by proprietary chromatographic techniques.
Source: Escherichia coli.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Endotoxin Level: Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.
Amino acid sequence:
METKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMETFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMETNADTDYSIAEAAFNKGETAMETTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMETENAQKGEIMETPNIPQMETSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGIEGRISEFGSMETIVKAGITIPRNPGCPNSEDKNFPRTVMETVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMETNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCT CVTPIVHHVA
Formulation & Storage: It was lyophilized from sterile 10 mM sodium phosphate ( pH 6.0) and we recommend that the powder be reconstituted in sterile 10 mW-cm H2O. Upon reconstitution Interleukin-17A should be stored at 4°C. For long-term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.
Usage: The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.
bio-equip.cn
ArkOne Biotechnologies, Inc. is a global distributor of high quality biochemical reagents and lab research tools for protein chemistry, molecular biology, and cell biology including a series of DNA vectors, purified proteins of high quality, and media for cell culture. The pre-selected media are suitable for stem cell culture, especially for those mammalian stem cells isolated from bone marrow, umbilical cord, and adipose tissues. By using these media, cells can be quickly expanded with minimal differentiation.The serum media contain essential and non-essential amino acids, vitamins, organic and inorganic compounds, hormones, growth factors, trace minerals and pre-selected fetal bovine serum and other supplements. The serum-free media contain defined animal-free components and key cytokine supplements, targeting clinical applicaiton. We also provide packaging services for a variety of viruses including intergrative viruses and non-integrative viruses of high titer. Integrative viruses are suitable for rapid generation of stable cell lines. These viruses include retrovirus and classical lentivirus. Non-integrative viruses include modified lentivirus, adenovirus and adeno-associated viruses (AAV) with serotypes ranging from AAV2/1 to AAV2/9. Non-integrative viruses can serve as excellent options for transient transfection as well as for gene delivery treatment (http://).
中文
