Product Name: Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 1(SRD5A1)
Product Type: Transmembrane Protein
Code: CSB-CF022653HU
Size: 10μg
Uniprot NO.: P18405
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Storage Buffer: Tris-based buffer,50% glycerol
Species: Homo sapiens (Human)
Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Gene Names: SRD5A1
Protein Names: Recommended name: 3-oxo-5-alpha-steroid 4-dehydrogenase 1 EC= 1.3.99.5Alternative name(s): SR type 1 Steroid 5-alpha-reductase 1 Short name= S5AR 1
Expression Region: 1-259
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info: His-SUMO-tag
Protein Description: full length protein
bio-equip.cn
Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.