Product Name: Recombinant Bovine Rod outer segment membrane protein 1(ROM1)
Product Type: Transmembrane Protein
Code: CSB-CF020062BO
Size: 10μg
Uniprot NO.: P52205
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Storage Buffer: Tris-based buffer,50% glycerol
Species: Bos taurus (Bovine)
Sequence:     MAPVLPLVLPLQPRIRLAQGLWLLSWLLVLVGGLTLLCSGHLLVQLWHLGTFLAPSCPFSALPQVALAASAVALGTGLVGSGASRASLDAEQYPPWRGVLGPLLVAGTAGGGGLLVLALGLALALPGTLDTGLEEGLGSALVHYKDTEVPGRCQAKRLLDELQLRHHCCGRHGYKDWFGIQWVSNRYLDPNDPDVVDRIQSNVEGLYLIDGVPFSCCNPHSPRPCLQSQLSDPHAHPLFDPRQPNLNLWSQGCHEVLLGHLQGLASTLGNMLAVTFLLQTLVLLGLRYLQTALEGLGGVIDGEGEAQGYLFPAGLKDMLKTAWLQGAGPHRPAPGETPPEEKPPKECLPEA
Gene Names: ROM1
Protein Names:    Recommended name: Rod outer segment membrane protein 1 Short name= ROSP1
Expression Region: 1-351
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info: His-SUMO-tag
Protein Description: full length protein

More details, please refer to http://www.cusabio.com/Transmembrane-Protein/Recombinant-Bovine-Rod-outer-segment-membrane-protein-1ROM1-11153751.html