Product Name: Recombinant Rat B2 bradykinin receptor(Bdkrb2)
Product Type: Transmembrane Protein
Code: CSB-CF002652RA
Size: 10μg
Uniprot NO.: P25023
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Storage Buffer:    Tris-based buffer,50% glycerol
Species: Rattus norvegicus (Rat)
Sequence: MDTRSSLCPKTQAVVAVFWGPGCHLSTCIEMFNITTQALGSAHNGTFSEVNCPDTEWWSWLNAIQAPFLWVLFLLAALENIFVLSVFCLHKTNCTVAEIYLGNLAAADLILACGLPFWAITIANNFDWLFGEVLCRVVNTMIYMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWSCTLLLSSPMLVFRTMKDYREEGHNVTACVIVYPSRSWEVFTNMLLNLVGFLLPLSIITFCTVRIMQVLRNNEMKKFKEVQTEKKATVLVLAVLGLFVLCWFPFQISTFLDTLLRLGVLSGCWNERAVDIVTQISSYVAYSNSCLNPLVYVIVGKRFRKKSREVYQAICRKGGCMGESVQMENSMGTLRTSISVDRQIHKLQDWAGNKQ
Gene Names: Bdkrb2
Protein Names: Recommended name: B2 bradykinin receptor Short name= B2R Short name= BK-2 receptor
Expression Region: 1-396
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info: His-SUMO-tag
Protein Description: full length protein

More details, please refer to http://www.cusabio.com/Transmembrane-Protein/Recombinant-Rat-B2-bradykinin-receptorBdkrb2-11153766.html

Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.