|
IgG4 Fc Protein, Human
| Origin of place |
Singapore  |
| Model |
UA050002-50μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
130 |
| Hits |
47 |
| Updated |
3/2/2026 |
|
Product Specification| Species | Human | | Synonyms | IgG4 Fc;Human IgG4 Fc protein, Ig gamma-4 chain C region, IgG4 Fc | | Accession | P01861 | | Amino Acid Sequence | ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK | | Expression System | HEK293 | | Molecular Weight | 30-32 KDa(Reducing) | | Purity | >95%, by SDS-PAGE under reducing conditions | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4, 5% trehalose | | Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
BackgroundImmunoglobulin G4 (IgG4), one of the four human IgG subtypes, is a monomer immunoglobulin mainly involved in secondary antibody reaction, which is produced and secreted by B cells. The IgG tetramer consists of two heavy chains (50 kDa) and two light chains (25 kDa) connected by disulfide bonds, which are two identical halves to form a Y shape. After pepsin cleavage, IgG was divided into two F (ab) s with one antigen binding site and a highly conserved Fc segment. The Fc segment has a highly conserved n-glycosylation site. IgG4 is the least common IgG among healthy adults, accounting for about 5% of the total IgG library. Although the amino acid sequence of IgG4 is about 90% homologous to other IgG subclasses, IgG4 is unique because it is a univalent function with little or no inflammation, and IgG4 Fc can bind to other Fc from all human IgG subclasses. IgG4 is generally considered to be a protective blocking antibody because it can inhibit or prevent inflammation by binding to inflammatory IgG subclasses or IgE competitive antigens. In addition, IgG4 can cause a subset of autoimmune diseases in severe diseases. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|