|
IL-4R alpha/CD124 His Tag Protein, Human
| Origin of place |
Singapore  |
| Model |
UA010382-100μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
720 |
| Hits |
25 |
| Updated |
12/2/2025 |
|
Product Specification| Species | Human | | Synonyms | IL-4R alpha, CD124, IL4R, IL4RA | | Accession | P24394 | | Amino Acid Sequence | Met26-His232, with C-terminal 8*His
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 36-54kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles. | | Reference | 1、Nelms K. et al. (2003) The IL-4 receptor: signaling mechanisms and biologic functions. Annual Review of Immunology. 17: 701-738. |
BackgroundIL-4Rα is a member of the hematopoietin receptor superfamily. Among the defining features of the members of this superfamily of receptors are shared structural motifs in the extracellular region, which consists of type III fibronectin domains. These motifs include conserved paired Cys residues and, in the membrane proximal region, a WSXWS motif. The latter has been proposed to be required for maintaining the receptor in a conformation favorable to cytokine binding. Structural alterations in the IL-4Rα extracellular region may result in altered receptor signaling capabilities. Indeed, a variant of the human IL-4Rα chain containing a Ile50Val substitution was isolated from atopic individuals and has been shown to enhance signal transduction resulting in the increased production of IgE. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|