|
CD5 His Tag Protein, Human
| Origin of place |
Singapore  |
| Model |
UA010390-100μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
618 |
| Hits |
25 |
| Updated |
12/2/2025 |
|
Product Specification| Species | Human | | Synonyms | CD5, LEU1 | | Accession | P06127 | | Amino Acid Sequence | Arg25-Asn371, with C-terminal 10*His
RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNGGGSGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 50-55kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles. | | Reference | 1、Zola H. et al. (2007) CD molecules 2006-human cell differentiation molecules. J Immunol Methods. 318(1-2): 1-5. 2、Ho I C. et al. (2009) GATA3 and the T-cell lineage: essential functions before and after T-helper-2-cell differentiation. Nat Rev Immunol. 9(2): 125-135. 3、Matesanz-Isabel J. et al. (2011) New B-cell CD molecules. Immunology Letters. 134(2): 104-112. |
BackgroundCD5, one of the earliest markers used to identify T cells, is a 67 kD transmembrane molecule that is constitutively expressed on all T cells and is a negative regulator of lymphocyte function. T-cell surface glycoprotein CD5 is also known as Lymphocyte antigen T1/Leu-1 and LEU1. CD5 is also a negative regulator of thymus cell stimulation. Lack of CD5 promotes positive selection of poorly selected thymocytes and increases negative selection of high-affinity clones. Along with its negative effect on T cell stimulation, CD5 was shown to diminish activation-induced cell death (AICD) through its interaction with casein kinase 2 (CK2). bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|