Product Specification| Species | Human | | Synonyms | CD72, LYB2, CD72b, Lyb-2, Lyb2 | | Accession | P21854 | | Amino Acid Sequence | Arg117-Asp359, with C-terminal 8* His
RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 30-35kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1、Wu H J. et al. (2009) CD72, a coreceptor with both positive and negative effects on B lymphocyte development and function. J Clin Immunol. 29: 12-21. 2、Adachi T. et al. (2000) CD72 negatively regulates signaling through the antigen receptor of B cells. J Immunol. 164: 1223-1229. |
BackgroundCD72 is a coreceptor of B cell receptor (BCR), which is expressed on all B cells starting at the pre-B cell stage, but its expression decreases significantly during differentiation into plasma cells. CD72 is a transmembrane receptor that is expressed as a homodimer. It has a conserved intracellular domain, which contains an immunoreceptor tyrosine-based inhibitory motif (ITIM) that binds SHP-1, a tyrosine phosphatase, and an ITIM-like motif that binds Grb2, an adaptor protein required to activate the Ras pathway. CD72 is known to play an important role in various B cell processes, including proliferation, apoptosis and differentiation. Mouse CD72 negatively regulates BCR signaling by recruiting Src homology 2 domain-containing protein tyrosine phosphatase-1 (SHP-1) at ITIM. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|