Product Specification| Species | Human | | Synonyms | PD-1, CD279, SLEB2, PDCD1 | | Accession | Q15116 | | Amino Acid Sequence | Leu25-Gln167, with C-terminal Avi & 8*His Tag
LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQGGGSGLNDIFEAQKIEWHEHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 30-43kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Biotin | | Tag | Avi Tag, His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1、Ishida Y. et al. (1992) Induced expression of PD-1, a novel member of the immunoglobulin gene superfamily, upon programmed cell death. EMBO J. 11: 3887. |
BackgroundProgrammed death 1 receptor (PD-1), also known as CD279, is a type I transmembrane protein belonging to the immune regulatory receptor CD28 family. PD-1 is expressed on the surface of activated T cells, B cells, macrophages, myelocytes, and a subset of thymocytes. Mature human PD-1 consists of a 148 amino acid (aa) extracellular region (ECD) with one immunoglobulin-like V-type domain, a 24 aa transmembrane domain, and a 95 aa cytoplasmic region. The tail of the cytoplasmic region contains two tyrosine residues, forming the immune receptor tyrosine inhibitory motif (ITIM) and immune receptor tyrosine switching motif (ITSM), which are important for mediating PD-1 signaling. PD-1 has two ligands, PD-L1 and PD-L2, which are members of the B7 family. PD-L1 is expressed in almost all mouse tumor cell lines, whereas the expression of PD-L2 is more restricted and mainly expressed by DC and a few tumor lines. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|