Product Specification| Species | Human | | Antigen | CTLA4 | | Synonyms | CTLA4,CD152 | | Accession | P16410 | | Amino Acid Sequence | Ala37 - Phe162, with
C-terminal 8*His&Avi tag AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHGLNDIFEAQKIEWHE
| | Expression System | HEK293 | | Molecular Weight | 20-27Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Biotin | | Tag | Avi Tag, His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1.Shuang Qin, Linping Xu, Ming Yi, Shengnan Yu,Kongming Wu & Suxia Luo: Novel immune checkpoint targets: moving beyondPD-1 and CTLA-4: MolecularCancer volume 18, Article number: 155 (2019).
|
BackgroundCytotoxic T-lymphocyte-associated protein 4
(CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin
subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and
ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80
and CD86, are typically found on the surface of antigen-presenting cells and
can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory
response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator
of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts
its inhibitory function can be categorized as either cell-intrinsic (affects
the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells).
CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28,
CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic
effects on the interacting cell. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|