Login    Join free Add to favorites    中文
Home >Products> Reagents >Other Reagents> CD200 His Tag Protein, Mouse
CD200 His Tag Protein, Mouse
CD200 His Tag Protein, Mouse
Origin of place Singapore
Model UA010491-100μg
Supplier ANT BIO PTE.LTD.
Price 594
Hits 55
Updated 12/2/2025
  • Product Detail
  • Company Profile

Product Specification


SpeciesMouse
AntigenCD200
SynonymsMy033,CD200 Antigen,Antigen Identified By Monoclonal Antibody MRC OX-2,MOX1,OX-2 Membrane Glycoprotein,OX-2,MRC,CD200 Molecule,MOX2
AccessionO54901
Amino Acid Sequence

Gln31-Gly232, with C-terminal 8*His

QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGGGGSHHHHHHHH

Expression SystemHEK293
Molecular Weight35-50kDa (Reducing)
Purity>95% by SDS-PAGE
Endotoxin<0.1EU/μg
ConjugationUnconjugated
TagHis Tag
Physical AppearanceLyophilized Powder
Storage BufferPBS, pH7.4
ReconstitutionReconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Barclay A.N., Wright G.J., Brooke G., Brown M.H.CD200 and membrane protein interactions in the control of myeloid cells. TrendsImmunol. 2002;23:285–290.
2.Wright G.J., Puklavec M.J., Willis A.C., HoekR.M., Sedgwick J.D., Brown M.H., Barclay A.N. Lymphoid/Neuronal cell surfaceOX2 glycoprotein recognizes a novel receptor on macrophages implicated in thecontrol of their function. Immunity. 2000;13:233–242.
3.Moreaux J., Veyrune J.L., Reme T., De Vos J.,Klein B. CD200, A putative therapeutic target in cancer. Biochem. Biophys. Res.Commun. 2008;366:117–122.
4.Barclay A.N. Different reticular elements in ratlymphoid tissue identified by localization of IA, Thy-1 and MRC OX-2 antigens.Immunology. 1981;44:727–736.

Background

CD200 is a type-1 cell membrane glycoprotein of the immunoglobulin supergene family, present on both cells with myeloid/lymphoid origin as well as on epithelial cells and many cancer cells. CD200, also known as MRC OX-2, is a highly conserved, 48 kDa type 1a transmembrane glycoprotein related structurally to the B7 family of costimulatory receptors.The molecule itself consists of an IgSF extracellular domain (single V + C), a single transmembrane region and a short cytoplasmic tail lacking signaling motifs. The molecule is expressed by resting dendritic cells, thymocytes, endothelial cells, neurons and osteoblast precursors (OBp), as well as by activated B and T cells (including αβTCR+ and most γδTCR+ cells). CD200 interacts with a structurally related receptor (CD200R) expressed mainly on myeloid cells and is involved in regulation of macrophage and mast cell function.  OX-2 / CD200 and CD200R associate via their respective N-terminal Ig-like domains.  CD200 also plays an important role in prevention of graft rejection, autoimmune diseases and spontaneous abortion.


bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Recently viewed products
Copyright(C) 2006-2025 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号