Product Specification| Species | Human | | Antigen | Fc γ RIIB/CD32b | | Synonyms | FCGR2B/C, CD32b/c, Fc RII-b/c, Fc-gamma RII-b/c, CD32, FCG2, IGFR2, CDw32 | | Accession | P31994-1 | | Amino Acid Sequence | Ala46-Pro217, with C-terminal Avi&His Tag
APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPGGGSGLNDIFEAQKIEWHEHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 29-32kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Biotin | | Tag | Avi Tag, His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1. Christopher T. Rankin, Maria-Concetta Veri, Sergey Gorlatov, Nadine Tuaillon, Steve Burke, Ling Huang, H. David Inzunza, Hua Li, Shannon Thomas, Syd Johnson, Jeffrey Stavenhagen, Scott Koenig, Ezio Bonvini: CD32B, the human inhibitory Fc-γ receptor IIB, as a target for monoclonal antibody therapy of B-cell lymphoma, Blood (2006) 108 (7): 2384-2391. |
BackgroundIgG Fc region receptors are members of the Ig superfamily that play roles in activating or inhibiting immune responses such as degranulation, phagocytosis, ADCC, cytokine release, and B-cell proliferation.
There are three genes for human Fc γ RII /CD32 (A, B, and C) and one for mouse Fc γ RII B (CD32B). CD32 is a low affinity receptor for IgG. CD32B is expressed on B cells and myeloid dendritic cells. Ligation of CD32B on B cells downregulates antibody production and may, in some circumstances, promote apoptosis. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|