Product Specification| Species | Human | | Synonyms | GP340 Protein, muclin | | Accession | Accession#:Q9UGM3-2 | | Amino Acid Sequence | Thr20-Ser220, with C-terminal 8*His
TGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTVAEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 35-50kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1. Review Int J Mol Sci . 2010;11(12):5212-33. Epub 2010 Dec 17. |
BackgroundDMBT1(missing in malignant brain tumor 1), also known as glycoprotein 340 and salivary agglutinin, is a secreted protein that belongs to the DMBT1 family. DMBT1 is highly expressed in alveolar and macrophage tissues. In some macrophages, expression is visible on the membrane, while in other macrophages, it is strongly expressed in the phagosome/phagolysosomal chamber. It is expressed in the lungs, trachea, salivary glands, small intestine and stomach. In the pancreas, it is expressed in certain cells on the island of Langerhans. DMBT1 plays an important role in innate immune response.Recent studies identify DMBT1 as a high affinity ligand of Siglec-8 in human airways. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|