Product Specification| Species | Rat | | Synonyms | Orosomucoid (OMD), Orm1 | | Accession | P02764 | | Amino Acid Sequence | Protein sequence (P02764, Gln19-Pro205, with C-His tag)
QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 23.3 kDa
Observed MW: 23-43 kDa | | Purity | 锛?5% by SDS-PAGE | | Endotoxin | <1EU/渭g | | Conjugation | Unconjugated | | Tag | with C-His tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundAlpha-1-acid glycoprotein, also known as orosomucoid, is a major acute-phase protein synthesized primarily in the liver. As a glycoprotein with high carbohydrate content, it exhibits increased plasma levels during inflammation, infection, or tissue injury, reflecting its role in immune modulation and host defense. Structurally, AGP binds to various ligands, including drugs, lipids, and cytokines, influencing drug pharmacokinetics and immune cell interactions. It is involved in regulating inflammation, modulating lymphocyte function, and potentially contributing to tumor progression. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|