Product Specification| Species | Human | | Synonyms | Antigen-presenting glycoprotein CD1d, R3G1, CD1d | | Accession | P15813 | | Amino Acid Sequence | Protein sequence (P15813, Val21-Gly296, with C-His tag)
VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWG | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 33 kDa
Observed MW: 43-55 kDa | | Purity | 锛?0% by SDS-PAGE | | Endotoxin | <1EU/渭g | | Conjugation | Unconjugated | | Tag | with C-His tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundCD1D is a non-classical MHC class I-like glycoprotein specializing in lipid antigen presentation to T cells, particularly natural killer T (NKT) cells. Unlike classical MHC molecules, it presents lipid and glycolipid antigens via a unique binding groove. Expressed on antigen-presenting cells, CD1D bridges innate and adaptive immunity by activating NKT cells to secrete cytokines, influencing responses to infections, autoimmunity, and cancer. Genetic variants are associated with diseases like type 1 diabetes. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|