Product Specification| Species | Human | | Synonyms | Tyrosine-protein phosphatase non-receptor type 1, Protein-tyrosine phosphatase 1B (PTP-1B), PTPN1 | | Accession | P18031 | | Amino Acid Sequence | Protein sequence (P18031, Met1-Asp298, with C-His tag)
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED | | Expression System | E.coli | | Molecular Weight | Predicted MW: 36.4 kDa
Observed MW: 35 kDa | | Purity | 锛?5% by SDS-PAGE | | Endotoxin | <0.1EU/渭g | | Conjugation | Unconjugated | | Tag | with C-His tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundProtein - tyrosine phosphatase 1B (PTP1B) is a crucial enzyme belonging to the protein tyrosine phosphatase family. PTP1B is widely distributed in various tissues such as adipose, liver, muscle, and epithelial cells, mainly located in the endoplasmic reticulum of the cytoplasm. It specifically hydrolyzes the phosphate group on the phosphorylated tyrosine residue, maintaining the balance of tyrosine protein phosphorylation with protein tyrosine kinases and participating in cell signal transduction. PTP1B negatively regulates the insulin and leptin signaling pathways, and its over - expression is closely related to the occurrence of type 2 diabetes, obesity, and other diseases. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|