Product Specification| Species | Human | | Synonyms | Ng, RC3, NRGN | | Accession | Q92686 | | Amino Acid Sequence | Protein sequence (Q92686, Met1-Asp78, with C-hFc tag)
MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 34.5 kDa
Observed MW: 43 kDa | | Purity | 锛?5% by SDS-PAGE | | Endotoxin | <0.1EU/渭g | | Conjugation | Unconjugated | | Tag | with C-hFc tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundNeurogranin is a small, acidic protein that is highly expressed in the central nervous system, particularly in neurons. It plays a pivotal role in synaptic plasticity, which is fundamental for learning and memory processes. Located in the postsynaptic density of excitatory synapses, Neurogranin binds to calmodulin. This binding is calcium - dependent. When intracellular calcium levels rise in response to neuronal activity, calcium - calmodulin complexes form. Neurogranin's interaction with calmodulin then modulates the activity of protein kinase C (PKC), an enzyme involved in signal transduction pathways. By regulating PKC, Neurogranin influences the phosphorylation of various synaptic proteins. This, in turn, impacts the structure and function of synapses, allowing for the strengthening or weakening of synaptic connections, essential for encoding and retrieving information in the brain. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|