Product Specification| Species | Human | | Synonyms | SLAM family member 6, Activating NK receptor, NK-T-B-antigen (NTB-A), CD352, SLAMF6, KALI | | Accession | Q96DU3 | | Amino Acid Sequence | Protein sequence (Q96DU3, Asn31-Gly239, with C-hFc tag)
NGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFG | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 49.6 kDa
Observed MW: 60-70 kDa | | Purity | 锛?5% by SDS-PAGE | | Endotoxin | <0.1EU/渭g | | Conjugation | Unconjugated | | Tag | with C-hFc tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundSLAM family member 6 is a protein that in humans is encoded by the SLAMF6 gene. The protein is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. It is expressed on natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|