Product Specification| Species | Mouse | | Synonyms | CCAAT/enhancer-binding protein delta, C/EBP delta, C/EBP-related protein 3, Cebpd, Crp3 | | Accession | Q00322 | | Amino Acid Sequence | "Protein sequence (Q00322, Ser2-Arg268, with N-hFc tag)
SAALFSLDSPVRGTPWPTEPAAFYEPGRVDKPGRGPEPGDLGELGSTTPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAAGAGGLELLQGGPTRPPGVGSVARGPLKREPDWGDGDAPGSLLPAQVAVCAQTVVSLAAAAQPTPPTSPEPPRGSPGPSLAPGTVREKGAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKKLPSPPFLPPTGADCR" | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 54.6 kDa
Observed MW: 45-90 kDa | | Purity | >90% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | with N-hFc tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundCCAAT/enhancer-binding protein delta is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. CEBPD is involved in regulation of apoptosis and cell proliferation. It probably acts as tumor suppressor. One study in mice showed that CEBPD prevents development of tubular injury and tubulointerstitial fibrogenesis during the progression of chronic obstructive nephropathy. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|