Product Specification| Species | Human |  | Synonyms | Granzyme A, CTL tryptase, Cytotoxic T-lymphocyte proteinase 1, Fragmentin-1, Granzyme-1, Hanukkah factor (H factor; HF), CTLA3, HFSP |  | Accession | P12544 |  | Amino Acid Sequence | Protein sequence (P12544, Glu27-Val262, with C-His tag)
EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV  |  | Expression System | HEK293 |  | Molecular Weight | Predicted MW: 27.8 kDa
Observed MW: 27.8 kDa  |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <0.1EU/μg |  | Conjugation | Unconjugated |  | Tag | with C-His tag |  | Physical Appearance | Lyophilized Powder |  | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.  |  
 BackgroundGranzyme A is a tryptase and is one of the five granzymes encoded in the human genome. This enzyme is present in cytotoxic T lymphocyte (CTL) granules. GzmA cleaves proteins after arginine or lysine basic residues. In CTL-targeted cells, it activates caspase-independent programmed cell death pathways that are unique and parallel to that of Granzyme B, although some substrates such as PARP-1 and lamin B are shared with Granzyme B. Substrates of GzmA include Pro-IL-1β, NDUFS3, SET, APE1, and Ku70 among others. In vitro studies suggest that GzmA may have less cytotoxic capabilities than GzmB. In colorectal cancer, GzmA was associated with promotion of cancer development, which may be due to activation of inflammation-inducing cytokines from macrophages. bio-equip.cn  
  AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   
 
 
 |