Product Specification| Species | Human | | Synonyms | Ig epsilon chain C region, Ig epsilon chain C region ND, IGHE | | Accession | P01854 | | Amino Acid Sequence | Protein sequence (P01854, Lys208-Gly427, with C-His tag)
KCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 26.3 kDa
Observed MW: 30 kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Tag | with C-His tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundIg epsilon chain C region is a protein that in humans is encoded by the IGHE gene. IGHE has been predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. IGHE has also been predicted to be located in extracellular region, a part of immunoglobulin complex, circulating, and active in external side of plasma membrane. Immunoglobulin E (IgE) are antibodies produced by the immune system. Each type of IgE has specific "radar" for each type of allergen. IgE-mediated food allergies is when the immune system reacts abnormally when exposed to one or more specific foods such as milk, egg, wheat or nuts. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|