Product Specification| Species | Human | | Synonyms | Leukocyte cell-derived chemotaxin-2, LECT-2, hLECT2 | | Accession | O14960 | | Amino Acid Sequence | Protein sequence (O14960, Gly19-Leu151, with C-10*His)
GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 16.3 kDa
Observed MW: 18 kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Tag | with C-10*His | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundLeukocyte cell-derived chemotaxin-2 (LECT2) is a chemotactic factor for neutrophils. Subsequent studies have defined LECT2 as a hepatokine. LECT is an evolutionary conserved protein, has one or more important functions, and may be involved in various diseases. Human LECT2 is a secreted, 16 kilodalton protein. Its structure is similar to that of the M23 family of metalloendopeptidases. LECT2 has not been found to possess enzymatic activity and does not appear to share any functions with M23 metalloendopeptidases. The liver hepatocyte is considered to be the source of the LECT2 circulating in blood. Several cell types or tissues, e.g. osteoblasts, chondrocytes, cardiac tissue, gastrointestinal smooth muscle cells, and epithelial cells of some tissues normally do not express LECT2 but do so under a variety of disease conditions. LECT2 amyloidosis (ALECT2) was the common (~3% of total) cause of amyloidosis. Circulating levels of LECT2 are elevated in >90% of individuals with hepatoblastoma and >20% of individuals with Hepatocellular carcinoma. In the latter form of liver cancer, LECT2 levels increase with increasingly poor prognostic stages of the disease and therefore may prove to be valuable prognostic markers. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|