Product Specification| Species | Rat | | Synonyms | Ig kappa chain C region, A allele | | Accession | P01836 | | Amino Acid Sequence | Protein sequence (P01836, Ala1-Cys106, with C-10*His)
ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNRNECGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 13.4 kDa
Observed MW: 15, 16 kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Tag | with C-10*His | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundImmunoglobulin G (IgG) is a type of antibody. IgG molecules are created and released by plasma B cells. Each IgG antibody has two paratopes. Antibodies are major components of humoral immunity. IgG is the main type of antibody found in blood and extracellular fluid, allowing it to control infection of body tissues. By binding many kinds of pathogens such as viruses, bacteria, and fungi, IgG protects the body from infection. IgG antibodies are large globular proteins made of four peptide chains; two identical γ (gamma) heavy chains of about 50 kDa and two identical light chains of about 25 kDa. light chain (L chain) refers to the small molecular weight peptide chain in immunoglobulin. According to its structure and the antigenicity of the constant region, it is divided into two types: kappa light chain and lambda light chain. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|