Product Specification| Species | Human | | Synonyms | Hepatocyte NOS (HEP-NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl-cysteine S-nitrosylase NOS2, NOS2A | | Accession | P35228 | | Amino Acid Sequence | Protein sequence (P35228, Ala2-Cys200, with C-10*His)
ACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 24.2 kDa
Observed MW: 43-55 kDa | | Purity | >90% by SDS-PAGE | | Endotoxin | <1EU/μg | | Tag | with C-10*His | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundNitric oxide synthases (NOSs) are a family of enzymes catalyzing the production of nitric oxide (NO) from L-arginine. NO is an important cellular signaling molecule. It helps modulate vascular tone, insulin secretion, airway tone, and peristalsis, and is involved in angiogenesis and neural development. Nitric oxide is mediated in mammals by the calcium-calmodulin controlled isoenzymes eNOS (endothelial NOS) and nNOS (neuronal NOS). Nitric oxide synthase, inducible (iNOS) is an enzyme which is encoded by the NOS2 gene in humans and mice. INOS involved in immune response, binds calmodulin at physiologically relevant concentrations, and produces NO as an immune defense mechanism. In mice, the function of Nos2 in immunity against a number of viruses, bacteria, fungi, and parasites has been well characterized. Nos2 is important for protective immunity against CMV. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|