|
Human CD127, His tag
| Origin of place |
Singapore  |
| Model |
S0A1084-10μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
120 |
| Hits |
60 |
| Updated |
3/2/2026 |
|
Product Specification| Species | Human | | Synonyms | CDw127 | | Accession | P16871 | | Amino Acid Sequence | Protein sequence (P16871, Glu21-Asp239, with C-10*His)
ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 26.9 kDa
Observed MW: 50 kDa | | Purity | >95% by SDS-PAGE | | Tag | with C-10*His | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. | | Reconstitution | Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundInterleukin-7 receptor subunit alpha (IL7R-α) also known as CD127 (Cluster of Differentiation 127) is a protein that in humans is encoded by the IL7R gene. IL7R-α is a type I cytokine receptor and is a subunit of the functional Interleukin-7 receptor and Thymic Stromal Lymphopoietin (TSLP) receptors that plays an important role in lymphocyte differentiation, proliferation, and survival. IL-7 R alpha is expressed on double negative (CD44-/CD8+) and CD4+ or CD8+ single positive T cells as well as on CD8+ memory T cells and their precursors. It is expressed early in B cell development, prior to the appearance of surface IgM. IL-7 induces the downregulation and shedding of cell surface IL‑7 R alpha.IL-7 R alpha additionally associates with TSLP R to form the functional receptor for thymic stromal lymphopoietin. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|