| 
		 
          
		    |   | Human CD47, His tag 
						  
							| Origin of place | Singapore  |  
							| Model | S0A1045-10μg |  
							| Supplier | ANT BIO PTE.LTD. |  
							| Price | 70 |  
							| Hits | 32 |  
							| Updated | 9/1/2025 |  |  
      | 
  Product Specification| Species | Human |  | Synonyms | Antigenic surface determinant protein OA3, Integrin-associated protein (IAP), Protein MER6 |  | Accession | Q08722 |  | Amino Acid Sequence | Protein sequence(Q08722, Gln19-Glu141, with C-10*His)
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGGGGSHHHHHHHHHH |  | Expression System | HEK293 |  | Molecular Weight | Theoretical:15.6kDa Actual:30-45kDa |  | Purity | >95% by SDS-PAGE |  | Tag | with C-10*His |  | Physical Appearance | Lyophilized Powder |  | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.  
Please avoid repeated freeze-thaw cycles. | 
BackgroundCD47 (Cluster of Differentiation 47) also known as integrin associated protein (IAP) is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 belongs to the immunoglobulin superfamily[5] and partners with membrane integrins and also binds the ligands thrombospondin-1 (TSP-1) and signal-regulatory protein alpha (SIRPα). CD-47 acts as a don't eat me signal to macrophages of the immune system which has made it a potential therapeutic target in some cancers, and more recently, for the treatment of pulmonary fibrosis. CD47 is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. Furthermore, it plays a key role in immune and angiogenic responses. CD47 is ubiquitously expressed in human cells and has been found to be overexpressed in many different tumor cells.bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |  | 
	 
	
	 
 
 
 |