| 
  Product Specification| Species | Human |  | Synonyms | L-selectin, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90-MEL, SELL, LNHR, LYAM1 |  | Accession | P14151 |  | Amino Acid Sequence | Protein sequence(P14151, Trp39-Asn332, with C-10*His)
WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNGGGGSHHHHHHHHHH |  | Expression System | HEK293 |  | Molecular Weight | Theoretical:34.7kDa Actual:50-70kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <1EU/μg |  | Tag | with C-10*His |  | Physical Appearance | Lyophilized Powder |  | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.  
Please avoid repeated freeze-thaw cycles. | 
BackgroundL-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. These tethering interactions are essential for the trafficking of monocytes and neutrophils into inflamed tissue as well as the homing of lymphocytes to secondary lymphoid organs. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. In addition to its function in the immune response, L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation. bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |