| 
  Product Specification| Species | Human |  | Synonyms | ANKRD30A |  | Accession | Q9BXX3 |  | Amino Acid Sequence | Protein sequence(Q9BXX3, Arg851-Leu928, with C-10*His)
RMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFPSESKQKKVEENSWDSESLGGGGSHHHHHHHHHH |  | Expression System | HEK293 |  | Molecular Weight | Theoretical:10.6kDa Actual:13-20kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <1EU/μg |  | Tag | His Tag |  | Physical Appearance | Lyophilized Powder |  | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.  
Please avoid repeated freeze-thaw cycles. | 
BackgroundANKRD30A has been previously identified as NY-BR-1 or antigen B726P. It was identified based on spontaneous humoural immune responses in breast cancer patients (Jäger et al. 2001, 2002). The protein is regarded as a putative transcription factor, as it contains a bipartite nuclear localization signal motif and a bZIP site (DNA-binding site followed by leucine zipper motif). Additional structural features include five tandem ankyrin repeats, implying a role for ANKRD30A in protein–protein interactions. In view of its highly restricted expression pattern, ANKRD30A may be considered as a breast differentiation antigen that could represent a suitable target for immunotherapy. Indeed, it was found in 80% of breast cancer specimens, while tumours of other histological types were ANKRD30A-negative. It was also identified in normal breast, normal testis, was inconsistent in prostate, and not found in other tissues. bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |