| 
  Product Specification| Species | Human |  | Synonyms | GMNN |  | Accession | O75496 |  | Amino Acid Sequence | Protein sequence(O75496, Leu110-Ile209, with C-10*His)MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH
 |  | Expression System | E.coli |  | Molecular Weight | Theoretical:13.1kDa Actual:19kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <1EU/μg |  | Tag | His Tag |  | Physical Appearance | Lyophilized Powder |  | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. | 
BackgroundGeminin is a nuclear protein present in most eukaryotes and highly conserved across species, numerous functions have been elucidated for geminin including roles in metazoan cell cycle, cellular proliferation, cell lineage commitment, and neural differentiation. One example of its function is the inhibition of Cdt1. Geminin has been found to be overexpressed in several malignancies and cancer cell lines, while there is data demonstrating that geminin acts as a tumor suppressor by safeguarding genome stability.bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |