| 
  Product Specification| Species | Human |  | Synonyms | C11, CTLA-1, Cathepsin G-like 1 (CTSGL1), Cytotoxic T-lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin-2, Granzyme-2, Human lymphocyte protein (HLP), SECT, T-cell serine protease 1-3E, CGL1, CSPB, GRB |  | Accession | P10144 |  | Amino Acid Sequence | Protein sequence(P10144, Gly19-Tyr247, with C-10*His)
GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRYGGGGSHHHHHHHHHH |  | Expression System | HEK293 |  | Molecular Weight | Theoretical:27.4kDa Actual:33kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <1EU/μg |  | Tag | His Tag |  | Physical Appearance | Lyophilized Powder |  | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.  
Please avoid repeated freeze-thaw cycles. | 
BackgroundGranzyme B (GZMB) is one of the serine protease granzymes most commonly found in the granules of natural killer cells (NK cells) and cytotoxic T cells. It is secreted by these cells along with the pore forming protein perforin to mediate apoptosis in target cells.Granzyme B has also been found to be produced by a wide range of non-cytotoxic cells ranging from basophils and mast cells to smooth muscle cells. The secondary functions of granzyme B are also numerous. Granzyme B has shown to be involved in inducing inflammation by stimulating cytokine release and is also involved in extracellular matrix remodelling. bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |