| 
		 
          
		    |   | E. coli MBP Protein, His tag 
						  
							| Origin of place | Singapore  |  
							| Model | S0A0132-25μg |  
							| Supplier | ANT BIO PTE.LTD. |  
							| Price | 185 |  
							| Hits | 30 |  
							| Updated | 9/1/2025 |  |  
      | 
  Product Specification| Species | E. coli |  | Synonyms | Maltose/maltodextrin-binding periplasmic protein, MMBP, Maltodextrin-binding protein, Maltose-binding protein (MBP), malE |  | Accession | P0AEX9 |  | Amino Acid Sequence | Protein sequence (P0AEX9, Lys27-Thr392, with C-His tag) 
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT |  | Expression System | E.coli |  | Molecular Weight | Predicted MW: 41.8 kDa
Observed MW: 42 kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <0.1EU/μg |  | Conjugation | Unconjugated |  | Tag | with C-His tag |  | Physical Appearance | Lyophilized Powder |  | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.6 months, -20 to -70 °C under sterile conditions after reconstitution.
 1 week, 2 to 8 °C under sterile conditions after reconstitution.
 Please avoid repeated freeze-thaw cycles.
 | 
BackgroundMaltose-binding protein (MBP) is a part of the maltose/maltodextrin system of Escherichia coli, which is responsible for the uptake and efficient catabolism of maltodextrins. It is a complex regulatory and transport system involving many proteins and protein complexes. MBP has an approximate molecular mass of 42.5 kilodaltons. MBP is used to increase the solubility of recombinant proteins expressed in E. coli. The fusion of proteins with MBP usually enhances their solubility and facilitates their proper folding. In addition, such fusions can facilitate the crystallization of difficult proteins, e.g. membrane proteins. MBP can itself be used as an affinity tag for purification of recombinant proteins.bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |  | 
	 
	
	 
 
 
 |