| 
		 
          
		    |   | Human MUC5AC , His tag 
						  
							| Origin of place | Singapore  |  
							| Model | S0A6022-25μg |  
							| Supplier | ANT BIO PTE.LTD. |  
							| Price | 100 |  
							| Hits | 34 |  
							| Updated | 9/1/2025 |  |  
      | 
  Product Specification| Species | Human |  | Synonyms | Gastric mucin, Major airway glycoprotein, Mucin-5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM |  | Accession | P98088 |  | Amino Acid Sequence | Protein sequence(P98088, Thr1850-Cys1950, with C-10*His)
TSTPGSTSSSPAQTTPSTTSKTTETQASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCGGGGSHHHHHHHHHH |  | Expression System | HEK293 |  | Molecular Weight | Theoretical:11.3kDa Actual:20-120kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <1EU/μg |  | Tag | His Tag |  | Physical Appearance | Lyophilized Powder |  | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.  
Please avoid repeated freeze-thaw cycles. | 
BackgroundMUC-5AC is a large gel-forming glycoprotein. In the respiratory tract it protects against infection by binding to inhaled pathogens that are subsequently removed by mucociliary clearance. Overproduction of MUC-5AC can contribute to diseases such as asthma and chronic obstructive pulmonary disease, and has also been associated with greater protection against influenza infection. This protein has been linked to mucus hypersecretion in the respiratory tract and is associated to chronic obstructive pulmonary disease (COPD).bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |  | 
	 
	
	 
 
 
 |