| 
		 
          
		    |   | Human C1q , His tag 
						  
							| Origin of place | Singapore  |  
							| Model | S0A6020-25μg |  
							| Supplier | ANT BIO PTE.LTD. |  
							| Price | 100 |  
							| Hits | 35 |  
							| Updated | 9/1/2025 |  |  
      | 
  Product Specification| Species | Human |  | Synonyms | Complement C1q subcomponent subunit A |  | Accession | P02745 |  | Amino Acid Sequence | Protein sequence(P02745, Glu23-Arg150, with C-10*His)
EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRGGGGSHHHHHHHHHH |  | Expression System | HEK293 |  | Molecular Weight | Theoretical:14.7kDa Actual:20-25kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <1EU/μg |  | Tag | His Tag |  | Physical Appearance | Lyophilized Powder |  | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.  
Please avoid repeated freeze-thaw cycles. | 
BackgroundThe complement component 1q (or simply C1q) is a protein complex involved in the complement system, which is part of the innate immune system. Antibodies of the adaptive immune system can bind antigen, forming an antigen-antibody complex. When C1q binds antigen-antibody complexes, the C1 complex becomes activated. Activation of the C1 complex initiates the classical complement pathway of the complement system. By virtue of its ability to bind to IgG and IgM containing immune complexes and activating the classical pathway, C1q acts as prototypical link between innate and adaptive immune wings of the immune system. The notion of C1q involvement in the pathogenesis of cancer is still evolving. C1q appears to have a dual role in cancer: tumor promoting as well as tumor-protective, depending on the context of the disease. bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |  | 
	 
	
	 
 
 
 |