| 
		 
          
		    |   | Mouse CD8, His tag 
						  
							| Origin of place | Singapore  |  
							| Model | S0A1018-10μg |  
							| Supplier | ANT BIO PTE.LTD. |  
							| Price | 185 |  
							| Hits | 34 |  
							| Updated | 9/1/2025 |  |  
      | 
  Product Specification| Species | Mouse |  | Synonyms | T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2 |  | Accession | P01731 |  | Amino Acid Sequence | Protein sequence(P01731, Gly23-Gly188, with C-10*His)GSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGGGGGSHHHHHHHHHH
 |  | Expression System | CHO |  | Molecular Weight | Theoretical:20.0kDa Actual:27-32kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <1EU/μg |  | Tag | His Tag |  | Physical Appearance | Lyophilized Powder |  | Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.  
Please avoid repeated freeze-thaw cycles. | 
BackgroundCD8 (cluster of differentiation 8) is a transmembrane glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). Along with the TCR, the CD8 co-receptor plays a role in T cell signaling and aiding with cytotoxic T cell-antigen interactions. Like the TCR, CD8 binds to a major histocompatibility complex (MHC) molecule, but is specific for the MHC class I protein. To function, CD8 forms a dimer, consisting of a pair of CD8 chains. The most common form of CD8 is composed of a CD8-α and CD8-β chain, both members of the immunoglobulin superfamily with an immunoglobulin variable (IgV)-like extracellular domain connected to the membrane by a thin stalk, and an intracellular tail.bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |  | 
	 
	
	 
 
 
 |