| 
		 
          
		    |   | Human DKK-1, His tag 
						  
							| Origin of place | Singapore  |  
							| Model | S0A6008-50μg |  
							| Supplier | ANT BIO PTE.LTD. |  
							| Price | 260 |  
							| Hits | 38 |  
							| Updated | 9/1/2025 |  |  
      | 
  Product Specification| Species | Human |  | Synonyms | Dickkopf-related protein 1, Dickkopf-1, Hdkk-1, SK |  | Accession | O94907 |  | Amino Acid Sequence | Protein sequence(O94907, Thr32-His266, with C-10*His)
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRHGGGGSHHHHHHHHHH |  | Expression System | HEK293 |  | Molecular Weight | Theoretical: 27.4kDa Actual: 45kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <1EU/μg |  | Conjugation | Unconjugated |  | Tag | His Tag |  | Physical Appearance | Lyophilized Powder |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 ℃ to -70 °C as supplied.  1 month, 2 to 8 °C under sterile conditions after reconstitution.   Please avoid repeated freeze-thaw cycles. | 
BackgroundDKK-1 is a member of the dickkopf family and is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the Wnt signaling pathway. DKK-1 is an antagonist of the Wnt/β-catenin signalling pathway that acts by isolating the LRP6 co-receptor so that it cannot aid in activating the WNT signaling pathway. Moreover, DKK-1 was demonstrated to antagonize the Wnt/β-catenin pathway via a reduction in β-catenin and an increase in OCT4 expression.This inhibition plays a key role in heart, head and forelimb development during anterior morphogenesis of the embryo. Elevated levels of DKK-1 in bone marrow, plasma and peripheral blood are associated with the presence of osteolytic bone lesions in patients with multiple myeloma. Due to the role of DKK-1 in inflammation induced bone loss DKK-1 is under investigation as target for therapeutic strategies in medicine and dentistry.bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |  | 
	 
	
	 
 
 
 |