| 
		 
          
		    |   | Human PCT(Procalcitonin), His Tag 
						  
							| Origin of place | Singapore  |  
							| Model | S0A0010-50μg |  
							| Supplier | ANT BIO PTE.LTD. |  
							| Price | 375 |  
							| Hits | 35 |  
							| Updated | 9/1/2025 |  |  
      | 
  Product Specification| Species | Human |  | Synonyms | PCT(Procalcitonin) |  | Accession | P01258 |  | Amino Acid Sequence | Protein sequence(P01258, Ala26-Asn141 with C-10*His) MAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ EREGSSLDSPRSKRCGNLST CMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANGGGGSHHHHHHHHHH
 |  | Expression System | E.coli |  | Molecular Weight | Theoretical: 14.6kDa Actual: 15kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <1EU/μg |  | Conjugation | Unconjugated |  | Tag | His Tag |  | Physical Appearance | Lyophilized Powder |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution.   Please avoid repeated freeze-thaw cycles.  | 
BackgroundProcalcitonin (PCT) is a peptide precursor of the hormone calcitonin. The level of procalcitonin in the blood stream of healthy individuals is below the limit of detection (0.01 µg/L) of clinical assays. The level of procalcitonin rises in a response to a pro-inflammatory stimulus, especially of bacterial origin. Due to PCT’s variance between microbial infections and healthy individuals, it has become a marker to improve identification of bacterial infection and guide antibiotic therapy.bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |  | 
	 
	
	 
 
 
 |