| 
  Product Specification| Species | MPXV |  | Synonyms | A29L, Mpox, Monkeypox |  | Accession | Q9YN60 |  | Amino Acid Sequence | Protein sequence(Q9YN60, Met1-Glu110 with C-10*His) MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH
 |  | Expression System | HEK293 |  | Molecular Weight | Theoretical: 14.2kDa Actual: 16-23kDa |  | Purity | >95% by SDS-PAGE |  | Endotoxin | <1EU/μg |  | Conjugation | Unconjugated |  | Tag | His Tag |  | Physical Appearance | Lyophilized Powder |  | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |  | Stability & Storage | 12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution.   Please avoid repeated freeze-thaw cycles.  | 
BackgroundA29L is highly homologous to Vaccinia virus envelope protein A27. A27 has multiple functions and is conserved in the Orthopoxvirus genus of the poxvirus family. A27 protein binds to cell surface heparan sulfate, provides an anchor for A26 protein packaging into mature virions, and is essential for egress of mature virus (MV) from infected cells. bio-equip.cnAntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
   |